Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHR YCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
    • Amino acids
      679 to 770
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bach 2
    • Bach2
    • BACH2_HUMAN
    • Basic leucine zipper transcription factor 2
    • BTB and CNC homolog 2
    • BTB and CNC homology 1 basic leucine zipper transcription factor 2
    • BTB domain and CNC homolog 2
    • BTBD25
    • OTTHUMP00000016867
    • OTTHUMP00000016868
    • OTTHUMP00000040591
    • Transcription regulator protein BACH2
    see all
  • Function
    Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Play important roles in coordinating transcription activation and repression by MAFK.
  • Tissue specificity
    B-cell specific.
  • Sequence similarities
    Belongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up