Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95816
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREEL NLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGN AKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
    • Molecular weight26 kDa including tags
    • Amino acids1 to 211
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104795 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BAG 2
    • BAG family molecular chaperone regulator 2
    • BAG-2
    • BAG-family molecular chaperone regulator-2
    • Bag2
    • BAG2_HUMAN
    • BCL 2 associated athanogene 2
    • Bcl-2-associated athanogene 2
    • BCL2 associated athanogene 2
    • BCL2-associated athanogene 2
    • dJ417I1.2
    • dJ417I1.2 (BAG family molecular chaperone regulator 2)
    • KIAA0576
    • MGC149462
    • OTTHUMP00000016668
    see all
  • FunctionInhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.
  • Sequence similaritiesContains 1 BAG domain.
  • Information by UniProt

Recombinant Human BAG2 protein images

  • 15% SDS-PAGE analysis of 3µg ab104795.

References for Recombinant Human BAG2 protein (ab104795)

ab104795 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"