Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95816
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREEL NLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGN AKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
    • Molecular weight26 kDa including tags
    • Amino acids1 to 211
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab124848 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under Desiccating conditions.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • BAG 2
    • BAG family molecular chaperone regulator 2
    • BAG-2
    • BAG-family molecular chaperone regulator-2
    • Bag2
    • BAG2_HUMAN
    • BCL 2 associated athanogene 2
    • Bcl-2-associated athanogene 2
    • BCL2 associated athanogene 2
    • BCL2-associated athanogene 2
    • dJ417I1.2
    • dJ417I1.2 (BAG family molecular chaperone regulator 2)
    • KIAA0576
    • MGC149462
    • OTTHUMP00000016668
    see all
  • FunctionInhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.
  • Sequence similaritiesContains 1 BAG domain.
  • Information by UniProt

References for Recombinant Human BAG2 protein (ab124848)

ab124848 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"