Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREA ATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTVE VSVETIRNPQQQESL KHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVI GCALEDQKKIKRRLE TLLRNIENSDKAIKLLEHSKGAGSKTLQQNAESRFN
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 211
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names
    • BAG 2
    • BAG family molecular chaperone regulator 2
    • BAG-2
    • BAG-family molecular chaperone regulator-2
    • Bag2
    • BAG2_HUMAN
    • BCL 2 associated athanogene 2
    • Bcl-2-associated athanogene 2
    • BCL2 associated athanogene 2
    • BCL2-associated athanogene 2
    • dJ417I1.2
    • dJ417I1.2 (BAG family molecular chaperone regulator 2)
    • KIAA0576
    • MGC149462
    • OTTHUMP00000016668
    see all
  • Function
    Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.
  • Sequence similarities
    Contains 1 BAG domain.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172178 under non reduced (lane 1) and reduced (lane 2) conditions.

References

ab172178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up