Overview

  • Product name
    Recombinant Human Bag5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQL FEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFEE AQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTGGKISLRKARY HTLTKIWAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVL IALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDIN KLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPS ELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEE LLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY
    • Amino acids
      1 to 447
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BAG family molecular chaperone regulator 5
    • BAG-5
    • BAG5
    • BAG5_HUMAN
    • Bcl 2 associated athanogene 5
    • Bcl-2-associated athanogene 5
    • BCL2 associated athanogene 5
    • KIAA0873
    see all
  • Function
    Inhibits both auto-ubiquitination of PARK2 and ubiquitination of target proteins by PARK2 (By similarity). May function as a nucleotide exchange factor for HSP/HSP70, promoting ADP release, and activating Hsp70-mediated refolding.
  • Sequence similarities
    Contains 5 BAG domains.
  • Domain
    The fifth BAG domain is responsible for the interaction with HSP70 nucleotide-binding domain.
  • Information by UniProt

Images

  • ab160533 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up