Overview

  • Product name
    Recombinant Human BAHD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTHTRRKSLPMLSSGLTGRREPLQMEDSNMEQGVEGVEPGMPESPGHLTG RRKNYPLRKRPLVPEKPKACKVLLTRLENVAGPRSADEADELPPDLPKPP SPAPSSEDPGLAQPRKRRLASLNAEALNNLLLEREDTSSLAGTRRSRAGD PHRSRDRDRATGGWSSSKKRPRLGDLGGGSRHLSPEPAPDEGPRRDGDPA PKRLASLNAAAFLKLSQERELPLRLPRAHAEVDGRSTEPPAPKAPRPKWP KVNGKNYPKAWQGASSGEAAGPPGWQGCPDEPWPSATPCGPSVQPSHKPL SKALESPLGLRPHLPLLMGGQAALKPEPGRPGEESPAPKQELHQPSFPTP QLSPLPMPGNPADYNGLCVGPELTALGSFYLYCGQEGLQCGGYSPCPMLP EGKLSPVAAPHEEGLLLAPSSVPSGTPFQHPPWGSSRYCSSEDTGVNGYS ICGVLPLSVTHAGTTCGGCPYKMPFAAEGCRSLGQLEFPLPEAGHPASPA HPLLGCPVPSVPPAAEPVPHLQTPTSEPQTVARACPQSAKPPSGSKSGLR TGSSCRHTARSKAARRPSHPKQPRVQRPRPRRRRRRRTNGWVPVGAACEK AVYVLDEPEPAIRKSYQAVERHGETIRVRDTVLLKSGPRKTSTPYVAKIS ALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNS VACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSADYSTPPHR TVPEDTDPELVFLCRHVYDFRHGRILKNPQ
    • Amino acids
      1 to 780
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AL022997
    • AW541238
    • BAH domain containing protein 1
    • BAH domain containing protein1
    • BAHDH 1
    • Bromo adjacent homology domain containing 1
    • Bromo adjacent homology domain containing1
    • Bromo adjacent homology domain-containing 1 protein
    • Gm117
    • KIAA0945
    • MGC117747
    • mKIAA0945
    • RGD1563127
    see all
  • Relevance
    BAHD1 (bromo adjacent homology domain-containing 1 protein) is, as its name suggests, a bromo-adjacent homology (BAH) domain. The BAH domain is found in eukaryotic DNA (cytosine-5) methyltransferases, the origin recognition complex 1 (Orc1) proteins, and several proteins involved in transcriptional regulation. It is thought to function as a protein-protein interaction domain. The BAH domain of yeast Sir3p has been shown to bind to nucleosomes and to the N-terminal tail of histone H3.
  • Cellular localization
    Nucleus. Note: Localizes to heterochromatin and inactive X chromosome. Colocalizes with histone H3 trimethylated at 'Lys-27' (H3K27me3).

Images

  • ab161466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up