Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFS KKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYD KNFIQIRRVFPTNFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTW LESCLKSENGRTESCGIMYTKCTCPQHLGEWGIDDQSLILLNNVVLPLNE QTEGCLTQELQTTQVCNLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKR VPQEQADAAKFMAQTGESGVEEWSQWSTCSVTCGQGSQVRTRTCVSPYGT HCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSCTP PQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGTQQRS RQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGG WERRIRTCQGAVITGQQCEGTGEEVRRCSEQRCPAPYEICPEDYLMSMVW KRTPAGDLAFNQCPLNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRH LQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFYAGDLLMSVEILR NVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIEL MQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKG RKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLIL PTLRNYTVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDD SKTNESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQPREIIMESS GTPSVTVDHHHHHH
    • Molecular weight
      98 kDa including tags
    • Amino acids
      25 to 880
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151879 was lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 5% Trehalose, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilised protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • BAI3
    • BAI3_HUMAN
    • Brain-specific angiogenesis inhibitor 3
    • dJ91B17.1 (brain specific angiogenesis inhibitor 3)
    • KIAA0550
    see all
  • Function
    Might be involved in angiogenesis inhibition and suppression of glioblastoma.
  • Tissue specificity
    Strongly expressed in brain. Also detected in heart. Reduced expression is observed in some glioblastoma cell lines.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 1 CUB domain.
    Contains 1 GPS domain.
    Contains 4 TSP type-1 domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up