Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAE GVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL GQFVVRRFFKS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 211

Specifications

Our Abpromise guarantee covers the use of ab114337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis regulator BAK
    • BAK
    • BAK like
    • Bak NT
    • BAK_HUMAN
    • Bak1
    • Bcl 2 homologous antagonist/killer
    • Bcl 2 like 7 protein
    • Bcl-2 homologous antagonist/killer
    • Bcl-2-like protein 7
    • BCL2 antagonist/killer 1
    • Bcl2 like 7 Protein
    • Bcl2-L-7
    • BCL2L7
    • CDN1
    • Cell death inhibitor 1
    • MGC117255
    • MGC3887
    • NBak
    • Pro apoptotic protein BAK
    see all
  • Function
    In the presence of an appropriate stimulus, accelerates programmed cell death by binding to, and antagonizing the anti-apoptotic action of BCL2 or its adenovirus homolog E1B 19k protein. Low micromolar levels of zinc ions inhibit the promotion of apoptosis.
  • Tissue specificity
    Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
  • Sequence similarities
    Belongs to the Bcl-2 family.
  • Domain
    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Recombinant Human Bak protein images

  • ab114337 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References for Recombinant Human Bak protein (ab114337)

ab114337 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up