Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTG FLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVL LGQFVVRRFFKS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      100 to 211

Specifications

Our Abpromise guarantee covers the use of ab114338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis regulator BAK
    • BAK
    • BAK like
    • Bak NT
    • BAK_HUMAN
    • Bak1
    • Bcl 2 homologous antagonist/killer
    • Bcl 2 like 7 protein
    • Bcl-2 homologous antagonist/killer
    • Bcl-2-like protein 7
    • BCL2 antagonist/killer 1
    • Bcl2 like 7 Protein
    • Bcl2-L-7
    • BCL2L7
    • CDN1
    • Cell death inhibitor 1
    • MGC117255
    • MGC3887
    • NBak
    • Pro apoptotic protein BAK
    see all
  • Function
    In the presence of an appropriate stimulus, accelerates programmed cell death by binding to, and antagonizing the anti-apoptotic action of BCL2 or its adenovirus homolog E1B 19k protein. Low micromolar levels of zinc ions inhibit the promotion of apoptosis.
  • Tissue specificity
    Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
  • Sequence similarities
    Belongs to the Bcl-2 family.
  • Domain
    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab114338 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up