Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEA SGQGNRYQHDGSRNLITKVQELTSSKELWFRAVDHHHHHH
    • Molecular weight
      16 kDa including tags
    • Amino acids
      21 to 152
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab152042 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • BAMBI
    • BAMBI_HUMAN
    • BMP and activin membrane bound inhibitor homolog
    • BMP and activin membrane-bound inhibitor homolog
    • NMA
    • Non metastatic gene A protein
    • Non-metastatic gene A protein
    • Putative transmembrane protein NMA
    see all
  • Function
    Negatively regulates TGF-beta signaling.
  • Tissue specificity
    High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
  • Sequence similarities
    Belongs to the BAMBI family.
  • Developmental stage
    Expression in poorly metastatic human melanoma cell lines; no expression in highly metastatic human melanoma cell lines.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab152042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up