Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATG YMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGT TIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQE LTSSKELWFRA
    • Molecular weight
      18 kDa including tags
    • Amino acids
      21 to 152
    • Additional sequence information
      Corresponding to teh Extracellular domain of human BAMBI, expressed with a small T7-His-TEV cleavage site Tag (29aa) at its N-terminal as inclusion bodies. (NP_036474.1).

Specifications

Our Abpromise guarantee covers the use of ab190409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    sterile-filtered, contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • BAMBI
    • BAMBI_HUMAN
    • BMP and activin membrane bound inhibitor homolog
    • BMP and activin membrane-bound inhibitor homolog
    • NMA
    • Non metastatic gene A protein
    • Non-metastatic gene A protein
    • Putative transmembrane protein NMA
    see all
  • Function
    Negatively regulates TGF-beta signaling.
  • Tissue specificity
    High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
  • Sequence similarities
    Belongs to the BAMBI family.
  • Developmental stage
    Expression in poorly metastatic human melanoma cell lines; no expression in highly metastatic human melanoma cell lines.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab190409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up