Overview

  • Product name
    Recombinant Human BANF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFL VLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
    • Amino acids
      1 to 89
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BAF
    • BAF_HUMAN
    • BANF 1
    • BANF1
    • Barrier to autointegration factor
    • Barrier to autointegration factor 1
    • Barrier-to-autointegration factor
    • BCRG 1
    • BCRG1
    • BCRP 1
    • BCRP1
    • Breakpoint cluster region protein 1
    • D14S1460
    • MGC111161
    • NGPS
    see all
  • Function
    Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging. Exploited by retroviruses for inhibiting self-destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD.
  • Tissue specificity
    Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the BAF family.
  • Domain
    Has a helix-hairpin-helix (HhH) structural motif conserved among proteins that bind non-specifically to DNA.
    LEM domain proteins bind centrally on the BAF dimer, whereas DNA binds to the left and right sides.
  • Post-translational
    modifications
    Partially phosphorylated on serine. Ser-4 phosphorylation may block BAF ability to promote EMD binding to lamins in vitro. Non phosphorylated BAF seems to enhances binding between EMD and LMNA.
  • Cellular localization
    Nucleus. Cytoplasm. Chromosome. Significantly enriched at the nuclear inner membrane, diffusely throughout the nucleus during interphase and concentrated at the chromosomes during the M-phase. May be included in HIV-1 virions via its interaction with viral GAG polyprotein.
  • Information by UniProt

Images

  • ab152917 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up