Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLF KWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVL LNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPR HLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDE EWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKV NRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR APAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNP TPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDD YEDDEEDDVQNTNSALRYKGKGTGKPGALSGSADGQLSVLQPNTINVLAE KLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIG SAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAV RDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVE KEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACL KEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRR RQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 729
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_004647.

Specifications

Our Abpromise guarantee covers the use of ab188681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration for use in vitro ranges from 1-5 µM depending on conditions and substrate.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.19% HEPES, 0.58% Sodium chloride, 10% Glycerol, 0.01% EDTA, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • BAP 1
    • Bap1
    • BAP1_HUMAN
    • BRCA 1 associated protein 1
    • BRCA1 associated protein 1
    • BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
    • BRCA1-associated protein 1
    • Cerebral protein 13
    • Cerebral protein 6
    • DKFZp686N04275
    • FLJ35406
    • FLJ37180
    • HUCEP 13
    • Hucep 6
    • HUCEP13
    • Hucep6
    • KIAA0272
    • TPDS
    • Ubiquitin carboxy terminal hydrolase
    • Ubiquitin carboxyl terminal hydrolase BAP 1
    • Ubiquitin carboxyl terminal hydrolase BAP1
    • Ubiquitin carboxyl-terminal hydrolase BAP1
    • UCHL2
    see all
  • Function
    Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains. Deubiquitination of HCFC1 does not lead to increase stability of HCFC1. Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Acts as a tumor suppressor.
  • Tissue specificity
    Highly expressed in testis, placenta and ovary. Expressed in breast.
  • Sequence similarities
    Belongs to the peptidase C12 family. BAP1 subfamily.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly nuclear. Binds to chromatin.
  • Information by UniProt

References

ab188681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up