Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNK AFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRS QRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKK FMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSK AQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
    • Amino acids
      1 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell receptor associated protein 29
    • BCAP29
    • BCR associated protein 29
  • Relevance
    BAP29 and the related protein BAP31 are endoplasmic reticulum (ER) and ER-vesicle membrane proteins and members of the B-cell receptor-associated protein family. These two proteins are highly homologous and can form homo- and heterodimers. Both BAP29 and BAP31 interact with membrane-bound immunoglobulins (mIgs), such as IgM and IgD, which with Ig-alpha/Ig-beta heterodimers form B cell antigen receptors. Binding of the BAP29/BAP31 heterodimer correlates with the ER retention of non-Ig-alpha/Ig-beta bound mIg complexes, suggesting that BAP29 and BAP31 may act as chaperones for transmembrane regions of various proteins. There are multiple isoforms of BAP29.
  • Cellular localization
    Endoplasmic reticulum

Images

  • ab163290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up