Overview

  • Product name
    Recombinant Human BASC4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEGMLLRLEEFCS LADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAFVKMVGHHVAF LEADVLQAERDHGAFPQALRRWLGSAGLPSFRNKSPAPVPVTYELPTLYR TEDYFPVDAGEAQHHPRTCPRPL
    • Amino acids
      1 to 173
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCAS4
    • BCAS4/BCAS3 fusion
    • BCAS4_HUMAN
    • Breast carcinoma amplified sequence 4
    • Breast carcinoma amplified sequence 4/3 fusion protein
    • Breast carcinoma-amplified sequence 4
    • CNOL
    • FLJ20495
    • RP5-1071L10.2
    see all
  • Tissue specificity
    Brain, thymus, spleen, kidney and placenta. Overexpressed in most breast cancer cell lines.
  • Involvement in disease
    Note=A chromosomal aberration involving BCAS4 has been found in some breast carcinoma cell lines. Translocation t(17;20)(q23;q13) with BCAS3.
  • Sequence similarities
    Belongs to the cappuccino family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163164 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up