Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSP ESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1033 to 1132

Specifications

Our Abpromise guarantee covers the use of ab152830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410045D21Rik
    • AA408914
    • BAG 6
    • BAG family molecular chaperone regulator 6
    • BAG-6
    • BAG6
    • BAG6_HUMAN
    • BAT 3
    • BCL2-associated athanogene 6
    • D17H6S52E
    • D6S52E
    • G3
    • HLA B associated transcript 3
    • HLA-B associated transcript 3
    • HLA-B associated transcript-3
    • HLA-B-associated transcript 3
    • large proline rich protein BAG6
    • Large proline rich protein BAT3
    • Large proline-rich protein BAG6
    • large proline-rich protein BAT3
    • Protein G3
    • Protein Scythe
    • Scythe
    • Scythe, homolog of Xenopus
    see all
  • Function
    Chaperone that plays a key role in various processes such as apoptosis, insertion of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane and regulation of chromatin. Acts in part by regulating stability of proteins and their degradation by the proteasome. Participates in endoplasmic reticulum stress-induced apoptosis via its interaction with AIFM1/AIF by regulating AIFM1/AIF stability and preventing its degradation. Also required during spermatogenesis for synaptonemal complex assembly via its interaction with HSPA2, by inhibiting polyubiquitination and subsequent proteasomal degradation of HSPA2. Required for selective ubiquitin-mediated degradation of defective nascent chain polypeptides by the proteasome. In this context, may play a role in immuno-proteasomes to generate antigenic peptides via targeted degradation, thereby playing a role in antigen presentation in immune response. Key component of the BAG6/BAT3 complex, a cytosolic multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. BAG6/BAT3 acts by facilitating TA membrane proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins and transfers them to ASNA1/TRC40 for targeting to the endoplasmic reticulum membrane. Also involved in DNA damage-induced apoptosis: following DNA damage, accumulates in the nucleus and forms a complex with p300/EP300, enhancing p300/EP300-mediated p53/TP53 acetylation leading to increase p53/TP53 transcriptional activity. When nuclear, may also act as a component of some chromatin regulator complex that regulates histone 3 'Lys-4' dimethylation (H3K4me2).
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Cleavage by caspase-3 releases a C-terminal peptide that plays a role in ricin-induced apoptosis.
    In case of infection by L.pneumophila, ubiquitinated by the SCF(LegU1) complex.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. The C-terminal fragment generated by caspase-3 is cytoplasmic.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152830 stained with Coomassie Blue.

References

ab152830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up