Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGD ESSAPDSQRSQTEPARERKRKKRRIMKAPAAEAVAEGASGRHGQGRSLEA EDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARDAFWWTPLMCA ARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESH GETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLP LGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRS APQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT YMNLEF
    • Amino acids
      1 to 356
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRD59
    • Ankyrin repeat domain containing protein 59
    • BAT 4
    • D6S54E
    • G patch domain and ankyrin repeats 1
    • G patch domain containing 10
    • G patch domain containing protein 10
    • G5
    • G5 protein
    • GPANK1
    • GPATCH10
    • HLA B associated transcript 4
    • Protein BAT4
    see all
  • Relevance
    BAT4 (HLA-B-associated transcript 4) contains two ANK repeats and one G-patch domain. It is thought to be involved in some aspects of immunity.
  • Cellular localization
    Endoplasmic reticulum

Images

  • ab159910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up