Overview

  • Product name
    Recombinant Human BBS12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLI SSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVE ECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQL ETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELF KPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPD GFQEHVTATHKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQ QGNCTKPFMFDISRIFTCCLPGLPETSSCVCPGYITVVSVSNNPVIKELQ NQPVRIVLIEGDLTENYRHLGFNKSANIKTVLDSMRLQEDSSEELWANHV LQVLIQFKVNLVLVQGNVSERLIEKCINSKRLVIGSVNGSVMQAFAEAAG AVQVAYITQVNEDCVGDGVCVTFWRSSPLDVVDRNNRIAILLKTEGINLV TAVLTNPVTAQMQIKEDRFWTCAYRLYYALKEEKVFLGGGAVEFLCLSCL HILAEQSLKKENHACSGWLHNTSSWLASSLAIYRPTVLKFLANGWQKYLS TLLYNTANYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNS DISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQIN SQELTGFLFL
    • Amino acids
      1 to 710
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bardet Biedl syndrome 12 protein
    • Bardet-Biedl syndrome 12 (human)
    • Bardet-Biedl syndrome 12 protein
    • Bardet-Biedl syndrome 12 protein homolog
    • BBS12
    • BBS12 gene
    • BBS12_HUMAN
    • C4orf24
    • FLJ35630
    • FLJ41559
    • Gm1805
    • Gm407
    • Gm721
    • RP23-137F6.2
    see all
  • Function
    Probable molecular chaperone. Assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Involved in adipogenic differentiation.
  • Involvement in disease
    Bardet-Biedl syndrome 12
  • Sequence similarities
    Belongs to the TCP-1 chaperonin family. BBS12 subfamily.
  • Cellular localization
    Cell projection, cilium. Located within the basal body of the primary cilium of differentiating preadipocytes.
  • Information by UniProt

Images

  • ab165782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up