Overview

  • Product name
    Recombinant Human BBS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQ HVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNL LAYDVYNNSDLFYREVADGANVVVLGTLGDISSPLAIIGGNCALQGFNHE GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM TETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAF DLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMD GHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLL ELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHT ELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKD VPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVN FTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKL SGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKV DEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDL NRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRD AIRSNNINTLFKIMRVGTASS
    • Amino acids
      1 to 721
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bardet Biedl syndrome 2
    • Bardet Biedl syndrome 2 protein
    • BBS
    • MGC20703
  • Relevance
    Defects in BBS2 are the cause of Bardet-Biedl syndrome type 2. Bardet-Biedl syndrome is a genetically heterogeneous, autosomal recessive disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation.
  • Cellular localization
    Cytoplasmic

Images

  • ab157956 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up