Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDR IQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLP VPVFKRKIP
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANGIE
    • ANGIE2
    • B cell attracting chemokine 1
    • B cell-attracting chemokine 1
    • B lymphocyte chemoattractant
    • B-cell chemoattractant
    • B-cell-attracting chemokine 1
    • B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1)
    • BCA-1
    • BLC
    • BLR1L
    • C-X-C motif chemokine 13
    • Chemokine (C-X-C motif) ligand 13
    • Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant)
    • Chemokine, CXC motif, ligand 13
    • CXC chemokine BLC
    • CXCL13
    • CXL13_HUMAN
    • SCYB13
    • Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant)
    • Small inducible cytokine B13
    • Small inducible cytokine subfamily B, member 13
    • Small-inducible cytokine B13
    see all
  • Function
    Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
  • Tissue specificity
    Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161046 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up