Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKS GSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPV FRTGSEPA
    • Amino acids
      266 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCAR 3
    • BCAR3
    • BCAR3_HUMAN
    • Breast cancer anti estrogen resistance 3
    • Breast cancer anti estrogen resistance protein 3
    • Breast cancer anti-estrogen resistance protein 3
    • Breast cancer antiestrogen resistance 3
    • dJ1033H22.2
    • dJ1033H22.2 breast cancer anti estrogen resistance 3
    • dJ1033H22.2 breast cancer antiestrogen resistance 3
    • KIAA0554
    • Novel SH2 containing protein 2
    • Novel SH2-containing protein 2
    • NSP 2
    • NSP2
    • SH2 containing protein Nsp2
    • SH2 domain containing protein 3B
    • SH2 domain-containing protein 3B
    • SH2D3B
    see all
  • Function
    May act as an adapter protein and couple activated growth factor receptors to a signaling pathway that regulates the proliferation in breast cancer cells. When overexpressed, it confers anti-estrogen resistance in breast cancer cell lines. May also be regulated by cellular adhesion to extracellular matrix proteins.
  • Tissue specificity
    Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue.
  • Sequence similarities
    Contains 1 Ras-GEF domain.
    Contains 1 SH2 domain.
  • Information by UniProt

Images

  • ab160021 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up