Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS YLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDIT AWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQK ELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQ LENEIYQIKQQHGEANKENIRQDF
    • Molecular weight
      26 kDa
    • Amino acids
      2 to 225
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 1.17% Sodium chloride, 0.32% Tris HCl

General Info

  • Alternative names
    • bcas2
    • Breast carcinoma amplified sequence 2
    • Breast carcinoma-amplified sequence 2
    • DAM1
    • DNA amplified in mammary carcinoma 1 protein
    • MGC7712
    • Pre mRNA splicing factor SPF27
    • Pre-mRNA-splicing factor spf27
    • Snt309
    • SPF27
    • SPF27_HUMAN
    • Spliceosome associated protein amplified in breast cancer
    • Spliceosome associated protein SPF 27
    • Spliceosome-associated protein SPF 27
    see all
  • Function
    Involved in mRNA splicing.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the SPF27 family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172154 under Reducing (lane 1)  and non reducing conditions (lane 2)

References

ab172154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up