Overview

  • Product name
    Recombinant Human BCAT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMASSSFKAADLQLEMTQKPHKKPGPG EPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLF EGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLI EVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFP GGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQV LWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLL DMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILY KDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
    • Molecular weight
      44 kDa including tags
    • Amino acids
      28 to 392
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • BCAM
    • BCAT 2
    • BCAT(m)
    • BCAT2
    • BCAT2_HUMAN
    • BCATM
    • BCT2
    • Branched chain aminotransferase 2, mitochondrial
    • Branched-chain-amino-acid aminotransferase
    • ECA40
    • mitochondrial
    • Placental protein 18
    • PP18
    see all
  • Function
    Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Cytoplasm and Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg loaded)

References

ab124554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up