Overview

  • Product nameRecombinant Human BCAT2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15382
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMASSSFKAADLQLEMTQKPHKKPGPG EPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLF EGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLI EVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFP GGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQV LWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLL DMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILY KDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
    • Molecular weight44 kDa including tags
    • Amino acids28 to 392
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • BCAM
    • BCAT 2
    • BCAT(m)
    • BCAT2
    • BCAT2_HUMAN
    • BCATM
    • BCT2
    • Branched chain aminotransferase 2, mitochondrial
    • Branched-chain-amino-acid aminotransferase
    • ECA40
    • mitochondrial
    • Placental protein 18
    • PP18
    see all
  • FunctionCatalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localizationCytoplasm and Mitochondrion.
  • Information by UniProt

Recombinant Human BCAT2 protein images

  • 15% SDS-PAGE (3 µg loaded)

References for Recombinant Human BCAT2 protein (ab124554)

ab124554 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"