Recombinant human Bcl-XL protein (ab180062)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA AESRKGQERFNR
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 212
    • Tags
      His tag C-Terminus
    • Additional sequence information
      (AAH19307)

Specifications

Our Abpromise guarantee covers the use of ab180062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized human BID protein at 10 μg/ml (100 μl/well) can bind biotinylated human Bcl-XL protein, The EC50 of biotinylated human Bcl-XL is 6.5 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Apoptosis regulator Bcl X
    • Apoptosis regulator Bcl-X
    • Apoptosis regulator BclX
    • B cell lymphoma 2 like
    • B2CL1_HUMAN
    • Bcl 2 like 1 protein
    • Bcl X
    • Bcl xL
    • BCL XL/S
    • Bcl xS
    • Bcl-2-like protein 1
    • Bcl2 Like 1
    • Bcl2 related gene
    • Bcl2-L-1
    • BCL2L
    • Bcl2l1
    • BCLX
    • BclXL
    • BclXs
    • DKFZp781P2092
    • PPP1R52
    • Protein phosphatase 1 regulatory subunit 52
    see all
  • Function
    Potent inhibitor of cell death. Inhibits activation of caspases (By similarity). Appears to regulate cell death by blocking the voltage-dependent anion channnel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane.
    Isoform Bcl-X(S) promotes apoptosis.
  • Tissue specificity
    Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
  • Sequence similarities
    Belongs to the Bcl-2 family.
  • Domain
    The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death.
  • Post-translational
    modifications
    Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity.
  • Cellular localization
    Mitochondrion membrane. Nucleus membrane. Mitochondrial membranes and perinuclear envelope.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab180062 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 26 kDa.

References

ab180062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up