Recombinant Human BCL2L12 protein (ab153540)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVR RRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRV LAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSES PRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGP PSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVE LFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLS VEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
    • Amino acids
      1 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B2L12_HUMAN
    • BCL 2 like 12
    • BCL 2 like 12 (proline rich)
    • BCL 2 like 12 isoform 1
    • Bcl 2 like 12 protein
    • Bcl 2 related proline rich protein
    • Bcl-2-like protein 12
    • Bcl-2-related proline-rich protein
    • BCL2 like 12
    • BCL2 like 12 (proline rich)
    • BCL2 like 12 isoform 1
    • Bcl2 like 12 protein
    • Bcl2 related proline rich protein
    • Bcl2-L-12
    • BCL2L12
    • BPR
    • MGC120313
    • MGC120314
    • MGC120315
    see all
  • Tissue specificity
    Expressed mainly in breast, thymus, prostate, fetal liver, colon, placenta, pancreas, small intestine, spinal cord, kidney, and bone marrow and to a lesser extent in many other tissues. Isoform 2 is primarily expressed in skeletal muscle.
  • Sequence similarities
    Belongs to the Bcl-2 family.
  • Information by UniProt

Images

  • ab153540 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up