Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGRTVRAETRSRAKDDIKKVMATIEK VRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERRGR GASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSP AGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEA PEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 217
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • B cell CLL/lymphoma 7 protein family member C
    • B cell CLL/lymphoma 7C
    • B-cell CLL/lymphoma 7 protein family member C
    • BCL 7C
    • Bcl7c
    • BCL7C_HUMAN
    see all
  • Function
    May play an anti-apoptotic role.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the BCL7 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174409 (3μg).

References

ab174409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up