Overview

  • Product name
    Recombinant Human BCL9L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQN TMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQS MEMERMMQAH
    • Amino acids
      606 to 715
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B-cell CLL
    • B-cell CLL/lymphoma 9-like protein
    • B-cell lymphoma 9-like protein
    • B9L
    • BCL9-2
    • BCL9-like protein
    • BCL9-related beta-catenin-binding protein
    • Bcl9l
    • BCL9L_HUMAN
    • DLNB11
    • Nuclear co factor of beta catenin signalling
    • Protein BCL9-2
    see all
  • Function
    Transcriptional regulator that acts as an activator. Promotes beta-catenin transcriptional activity. Plays a role in tumorigenesis. Enhances the neoplastic transforming activity of CTNNB1.
  • Tissue specificity
    Expressed in breast, ductal and invasive ductal carcinomas of the breast, sporadic colorectal adenomas and carcinomas (at protein level). Expressed in fetal brain. Expressed in lung, amygdala, eye, prostate, pancreatic and prostate cancers, head and neck tumors and embryonal tumor.
  • Sequence similarities
    Belongs to the BCL9 family.
  • Domain
    Tne C-terminal domain is important for its transactivation activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab166117 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up