Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
    • Molecular weight
      5 kDa
    • Amino acids
      5 to 54

Associated products

Specifications

Our Abpromise guarantee covers the use of ab111458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity
    >= 98 % SDS-PAGE.
    ab111458 is purified by standard chromatographic techniques. Purity is greater than 98% by HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituents: 0.76% Sodium chloride, 0.28% Sodium phosphate

  • Reconstitution
    Reconstitute in sterile ddH2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers.

General Info

  • Alternative names
    • B cell maturation antigen
    • B cell maturation factor
    • B cell maturation protein
    • B-cell maturation protein
    • BCM
    • BCMA
    • CD269
    • CD269 antigen
    • TNFRSF17
    • TNR17_HUMAN
    • Tumor necrosis factor receptor superfamily member 17
    see all
  • Function
    Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
  • Tissue specificity
    Expressed in mature B-cells, but not in T-cells or monocytes.
  • Involvement in disease
    Note=A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
  • Sequence similarities
    Contains 1 TNFR-Cys repeat.
  • Cellular localization
    Cell membrane. Endomembrane system. Perinuclear Golgi-like structures.
  • Information by UniProt

References for Recombinant Human BCMA protein (ab111458)

ab111458 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up