Recombinant Human BCRP/ABCG2 protein (ab152987)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPS ILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDS LTLLASGRLM
    • Amino acids
      156 to 265
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC transporter
    • ABC15
    • ABCG 2
    • ABCG2
    • ABCG2_HUMAN
    • ABCP
    • ATP binding cassette sub family G (WHITE) member 2
    • ATP binding cassette transporter G2
    • ATP-binding cassette sub-family G member 2
    • BCRP
    • BCRP1
    • BMDP
    • Breast cancer resistance protein
    • CD338
    • CDw338
    • CDw338 antigen
    • EST157481
    • GOUT1
    • MGC102821
    • Mitoxantrone resistance associated protein
    • Mitoxantrone resistance-associated protein
    • MRX
    • Multi drug resistance efflux transport ATP binding cassette sub family G (WHITE) member 2
    • MXR
    • MXR1
    • Placenta specific ATP binding cassette transporter
    • Placenta specific MDR protein
    • Placenta-specific ATP-binding cassette transporter
    • UAQTL1
    see all
  • Function
    Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux. Appears to play a major role in the multidrug resistance phenotype of several cancer cell lines. When overexpressed, the transfected cells become resistant to mitoxantrone, daunorubicin and doxorubicin, display diminished intracellular accumulation of daunorubicin, and manifest an ATP-dependent increase in the efflux of rhodamine 123.
  • Tissue specificity
    Highly expressed in placenta. Low expression in small intestine, liver and colon.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
    Contains 1 ABC transmembrane type-2 domain.
    Contains 1 ABC transporter domain.
  • Post-translational
    modifications
    Glycosylation-deficient ABCG2 is normally expressed and functional.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab152987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up