Overview

  • Product name
    Recombinant human BD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Molecular weight
      4 kDa
    • Amino acids
      24 to 64

Specifications

Our Abpromise guarantee covers the use of ab116473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by the ability to chemoattract Human dendritic immature cells at a concentration of 10,000-100,000ng/ml corresponding to a specific activity of 10-100IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity
    > 95 % SDS-PAGE.
    ab116473 is purified by proprietary chromatographic techniques. Purity is greater than 98.0% as determined by RP-HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized ab116473 is stable at room temperature for 3 weeks, long term it should be stored desiccated below -18°C. Upon reconstitution ab116473 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 0.48% PBS, 0.76% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute in sterile ultra pure water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • BD 2
    • Beta defensin 2
    • DEFB 102
    • Defb 2
    • Defb 4
    • DEFB102
    • Defb2
    • Defb4
    • Defensin beta 2
    • Defensin beta 4
    • hBD 2
    • hBD2
    • mBD 2
    • mBD2
    • SAP 1
    • SAP1
    • Skin antimicrobial peptide 1
    see all
  • Cellular localization
    Secreted

References

ab116473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up