Overview

  • Product name
    Recombinant human BD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Molecular weight
      4 kDa
    • Amino acids
      24 to 64

Specifications

Our Abpromise guarantee covers the use of ab116473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by the ability to chemoattract Human dendritic immature cells at a concentration of 10,000-100,000ng/ml corresponding to a specific activity of 10-100IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity
    > 95 % SDS-PAGE.
    ab116473 is purified by proprietary chromatographic techniques. Purity is greater than 98.0% as determined by RP-HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized ab116473 is stable at room temperature for 3 weeks, long term it should be stored desiccated below -18°C. Upon reconstitution ab116473 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 0.48% PBS, 0.76% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute in sterile ultra pure water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • BD 2
    • Beta defensin 2
    • DEFB 102
    • Defb 2
    • Defb 4
    • DEFB102
    • Defb2
    • Defb4
    • Defensin beta 2
    • Defensin beta 4
    • hBD 2
    • hBD2
    • mBD 2
    • mBD2
    • SAP 1
    • SAP1
    • Skin antimicrobial peptide 1
    see all
  • Cellular localization
    Secreted

References for Recombinant human BD2 protein (ab116473)

ab116473 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up