Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLATRLSRPLSRLPGKTLSACDRENGARRP LLLGSTSFIPIGRRTYASAAEPVGSKAVLVTGCDSGFGFALAKHLHSKGF LVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSS LKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFL PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLG VKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEK IAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMT HLPGAISDMIYIR
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 343
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    As determined by SEC-HPLC and reducing SDS-PAGE
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.6% Tris, 0.02% DTT

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • 3 hydroxybutyrate dehydrogenase (heart, mitochondrial)
    • 3-hydroxybutyrate dehydrogenase
    • BDH
    • BDH_HUMAN
    • BDH1
    • D beta hydroxybutyrate dehydrogenase, mitochondrial
    • D-beta-hydroxybutyrate dehydrogenase
    • mitochondrial
    see all
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab173016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up