Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGRLDGKVIILTAAAQGIGQAAALAFAREG AKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFN VAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIIN MSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESA YVTGNPVIIDGGWSL
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 245
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103058 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 3 hydroxybutyrate dehydrogenase type 2
    • 3-hydroxybutyrate dehydrogenase type 2
    • BDH 2
    • BDH2
    • BDH2_HUMAN
    • Dehydrogenase/reductase (SDR family) member 6
    • Dehydrogenase/reductase SDR family member 6
    • DHRS6
    • EFA6R
    • FLJ13261
    • Oxidoreductase ucpA
    • PRO20933
    • R beta hydroxybutyrate dehydrogenase
    • R-beta-hydroxybutyrate dehydrogenase
    • SDR15C1
    • Short chain dehydrogenase/reductase family 15C member 1
    • UCPA OR
    • UNQ6308
    see all
  • Function
    Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. Also acts as a 3-hydroxybutyrate dehydrogenase.
  • Pathway
    Siderophore biosynthesis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human BDH2 protein images

  • 15% SDS-PAGE (3 µg)

References for Recombinant Human BDH2 protein (ab103058)

ab103058 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up