Recombinant Human BDP / ARID3B protein (ab161075)

Overview

  • Product name
    Recombinant Human BDP / ARID3B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQP TLLSATAGRPSGSTPLGPLARVPPTAAVAQVFERGNMNSEPEEEDGGLED EDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNLLPAPGLPPHG QQAKEDHTKDASKASPSVSTAGQPNWNLDEQLKQNGGLAWSDDADGGRGR EISRDFAKLYELDGDPERKEFLDDLFVFMQKRGECASTHHSNSGNTDRVP TVC
    • Amino acids
      1 to 253
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARI3B_HUMAN
    • ARID domain containing protein 3B
    • ARID domain-containing protein 3B
    • Arid3b
    • AT rich interactive domain 3B BRIGHT like
    • AT rich interactive domain containing protein 3B
    • AT-rich interactive domain-containing protein 3B
    • Bright and dead ringer gene product homologous protein Bdp
    • Bright and dead ringer protein
    • Bright like
    • Bright-like protein
    • Brightlike
    • DRIL2
    see all
  • Function
    Transcription factor which may be involved in neuroblastoma growth and malignant transformation. Favors nuclear targeting of ARID3A.
  • Tissue specificity
    Expressed in placenta, testis and leukocytes. Expressed in neuroblastoma. Present in K562 erythrocytic leukemia cells (at protein level).
  • Sequence similarities
    Contains 1 ARID domain.
    Contains 1 REKLES domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161075 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up