Recombinant Human Beta-1,4-galactosyltransferase 6 protein (ab160435)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLP ENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGG
    • Amino acids
      48 to 145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4-galactosyltransferase
    • 4-galactosyltransferase 6
    • 4-GalTase 6
    • AA536803
    • AU022389
    • b4Gal-T6
    • B4galt6
    • B4GT6_HUMAN
    • Beta-1
    • beta-1,4-galactosyltransferase 6
    • beta-1,4-GalTase 6
    • Beta4Gal-T6
    • beta4GalT-VI
    • LacCer synthase
    • Lactosylceramide synthase
    • UDP-Gal:beta-GlcNAc beta-1
    • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6
    • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
    • UDP-Gal:glucosylceramide beta-1
    • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase
    • UDP-galactose:beta-N-acetylglucosamine beta-1
    • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6
    see all
  • Function
    Required for the biosynthesis of glycosphingolipids.
  • Tissue specificity
    High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 7 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt

Images

  • ab160435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up