Recombinant Human beta-cardiac myosin heavy chain protein (ab112326)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12883
    • SpeciesHuman
    • SequenceMGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAK IVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPA VLYNLKDRY
    • Molecular weight38 kDa including tags
    • Amino acids1 to 109
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • cardiomyopathy, hypertrophic 1
    • CMD1S
    • CMH1
    • MPD1
    • MyHC beta
    • MYHCB
    • Myosin heavy chain, cardiac muscle beta isoform
    • myosin, heavy polypeptide 7, cardiac muscle, beta
    see all
  • RelevanceMuscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Cardiac MHC exists as two isoforms in humans, alpha-cardiac MHC and beta-cardiac MHC. These two isoforms are expressed in different amounts in the human heart. During normal physiology, beta-cardiac MHC is the predominant form, with the alpha-isoform contributing around only 7% of the total MHC. Mutations of the MHC genes are associated with several different dilated and hypertrophic cardiomyopathies.
  • Cellular localizationThick filaments of the myofibrils.

Recombinant Human beta-cardiac myosin heavy chain protein images

  • ab112326 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human beta-cardiac myosin heavy chain protein (ab112326)

ab112326 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"