Recombinant Human beta-cardiac myosin heavy chain protein (ab112326)

Overview

  • Product name
    Recombinant Human beta-cardiac myosin heavy chain protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAK IVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPA VLYNLKDRY
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 109
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • cardiomyopathy, hypertrophic 1
    • CMD1S
    • CMH1
    • MPD1
    • MyHC beta
    • MYHCB
    • Myosin heavy chain, cardiac muscle beta isoform
    • myosin, heavy polypeptide 7, cardiac muscle, beta
    see all
  • Relevance
    Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Cardiac MHC exists as two isoforms in humans, alpha-cardiac MHC and beta-cardiac MHC. These two isoforms are expressed in different amounts in the human heart. During normal physiology, beta-cardiac MHC is the predominant form, with the alpha-isoform contributing around only 7% of the total MHC. Mutations of the MHC genes are associated with several different dilated and hypertrophic cardiomyopathies.
  • Cellular localization
    Thick filaments of the myofibrils.

Images

  • ab112326 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up