Recombinant Human beta Casein protein (ab123168)

Overview

  • Product nameRecombinant Human beta Casein protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP05814
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMRETIESLSSSEESITEYKQKVEKVK HEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVV LPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRA VPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
    • Molecular weight27 kDa including tags
    • Amino acids16 to 226
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123168 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.002% PMSF, 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 2.92% Sodium chloride

General Info

  • Alternative names
    • Beta-casein
    • CASB
    • CASB_HUMAN
    • Casein beta
    • CSN 2
    • Csn2
    see all
  • FunctionImportant role in determination of the surface properties of the casein micelles.
  • Tissue specificityMammary gland specific. Secreted in milk.
  • Sequence similaritiesBelongs to the beta-casein family.
  • Post-translational
    modifications
    Form 1-P is phosphorylated once; half of the molecules are phosphorylated on Ser-24, half on Ser-25.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human beta Casein protein images

  • 15% SDS-PAGE showing ab123168 (3 µg) at approximately 26.6 kDa.

References for Recombinant Human beta Casein protein (ab123168)

ab123168 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"