Recombinant Human beta Casein protein (ab123168)

Overview

  • Product name
    Recombinant Human beta Casein protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMRETIESLSSSEESITEYKQKVEKVK HEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVV LPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRA VPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
    • Molecular weight
      27 kDa including tags
    • Amino acids
      16 to 226
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123168 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.002% PMSF, 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 2.92% Sodium chloride

General Info

  • Alternative names
    • Beta-casein
    • CASB
    • CASB_HUMAN
    • Casein beta
    • CSN 2
    • Csn2
    see all
  • Function
    Important role in determination of the surface properties of the casein micelles.
  • Tissue specificity
    Mammary gland specific. Secreted in milk.
  • Sequence similarities
    Belongs to the beta-casein family.
  • Post-translational
    modifications
    Form 1-P is phosphorylated once; half of the molecules are phosphorylated on Ser-24, half on Ser-25.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab123168 (3 µg) at approximately 26.6 kDa.

References

ab123168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up