Recombinant Human Beta crystallin S protein (ab111642)

Overview

  • Product nameRecombinant Human Beta crystallin S protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP22914
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSKTGTKITFYEDKNFQGRRYDCDCD CADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGL NDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMRE IHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRI VE
    • Molecular weight24 kDa including tags
    • Amino acids1 to 178
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab111642 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride
    Note: Contains 89% Tris-HCl buffer.

General Info

  • Alternative names
    • AI327013
    • Beta-crystallin S
    • CRBS_HUMAN
    • CRYG8
    • crygs
    • Crystallin, gamma 8
    • Crystallin, gamma polypeptide 8
    • Crystallin, gamma S
    • CTRCT20
    • Gamma crystallin S
    • Gamma S crystallin
    • Gamma-crystallin S
    • Gamma-S-crystallin
    • Opacity due to poor secondary fiber cell junction; recessive nuclear cataract
    • Opj
    • rncat
    see all
  • FunctionCrystallins are the dominant structural components of the vertebrate eye lens.
  • Sequence similaritiesBelongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • DomainHas a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Information by UniProt

Recombinant Human Beta crystallin S protein images

  • 15% SDS-PAGE analysis of ab111642 (3 µg)

References for Recombinant Human Beta crystallin S protein (ab111642)

ab111642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"