Recombinant Human Beta crystallin S protein (ab111642)

Overview

  • Product name
    Recombinant Human Beta crystallin S protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMSKTGTKITFYEDKNFQGRRYDCDCD CADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGL NDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMRE IHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRI VE
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 178
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab111642 is purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride
    Note: Contains 89% Tris-HCl buffer.

General Info

  • Alternative names
    • AI327013
    • Beta-crystallin S
    • CRBS_HUMAN
    • CRYG8
    • crygs
    • Crystallin, gamma 8
    • Crystallin, gamma polypeptide 8
    • Crystallin, gamma S
    • CTRCT20
    • Gamma crystallin S
    • Gamma S crystallin
    • Gamma-crystallin S
    • Gamma-S-crystallin
    • Opacity due to poor secondary fiber cell junction; recessive nuclear cataract
    • Opj
    • rncat
    see all
  • Function
    Crystallins are the dominant structural components of the vertebrate eye lens.
  • Sequence similarities
    Belongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • Domain
    Has a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Information by UniProt

Recombinant Human Beta crystallin S protein images

  • 15% SDS-PAGE analysis of ab111642 (3 µg)

References for Recombinant Human Beta crystallin S protein (ab111642)

ab111642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up