Recombinant Human beta Sarcoglycan protein (ab152677)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLV ITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYET HEFHLPSGVK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      87 to 196

Specifications

Our Abpromise guarantee covers the use of ab152677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 43 kDa dystrophin associated glycoprotein
    • 43 kDa dystrophin-associated glycoprotein
    • 43DAG
    • A3b
    • Beta SG
    • Beta-sarcoglycan
    • Beta-SG
    • dystrophin-associated glycoprotein, 43-kD
    • LGMD2E
    • Limb girdle muscular dystrophy 2E (non linked families)
    • Sarcoglycan beta
    • sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
    • SGC
    • SGCB
    • SGCB_HUMAN
    see all
  • Function
    Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificity
    Highest expression in heart and skeletal muscle. Low expression in brain, kidney, placenta, pancreas and lung. High expression in fetal brain. Also found in fetal lung, kidney and liver.
  • Involvement in disease
    Limb-girdle muscular dystrophy 2E
  • Sequence similarities
    Belongs to the sarcoglycan beta/delta/gamma/zeta family.
  • Post-translational
    modifications
    Disulfide bonds are present.
  • Cellular localization
    Cell membrane, sarcolemma. Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152677 stained with Coomassie Blue.

References

ab152677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up