Recombinant Human beta TRCP2 protein (ab161589)

Overview

  • Product name
    Recombinant Human beta TRCP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKR PSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKP MLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGML WKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKII QDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIK IWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVL NTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHR AAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRD RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDG KIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDT ILIWDFLNVPPSAQNETRSPSRTYTYISR
    • Amino acids
      1 to 529
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • beta Transducin Repeat Containing Protein 2
    • BTRC2
    • BTRCP2
    • F-box and WD repeats protein beta-TrCP2
    • F-box and WD-40 Domain Protein 1B
    • F-box Protein FBW1B
    • F-box/WD repeat-containing protein 11
    • F-box/WD repeat-containing protein 1B
    • FBW1B
    • FBW1B_HUMAN
    • FBXW11
    • FBXW1B
    • Homologous to Slimb protein
    • HOS
    see all
  • Function
    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(FBXW11) mediates the ubiquitination of phosphorylated NFKBIA, which degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. Targets phosphorylation-dependent degradation of beta-catenin. Involved in the oxidative stress-induced a ubiquitin-mediated decrease in RCAN1. Mediates the degradation of CDC25A induced by ionizing radiation in cells progressing through S phase and thus may function in the intra-S-phase checkpoint. Has an essential role in the control of the clock-dependent transcription via degradation of PER1 and phosphorylated PER2. Is target of human immunodeficiency virus type 1 (HIV-1) protein VPU to polyubiquitinate and deplete BST2 from cells and antagonize its antiviral action.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 WD repeats.
  • Domain
    The N-terminal D domain mediates homodimerization.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab161589 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up