Recombinant Human Betacellulin protein (ab113162)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQS KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLF Y
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 101
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113162 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Betacellulin
    • Betacellulin precursor
    • BTC
    • BTC_HUMAN
    • OTTHUMP00000160600
    • OTTHUMP00000219057
    • Probetacellulin
    see all
  • Function
    Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the EGF receptor and other related receptors.
  • Tissue specificity
    Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Recombinant Human Betacellulin protein images

  • ab113162 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human Betacellulin protein (ab113162)

ab113162 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up