Overview

  • Product name
    Recombinant Human Bex1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMESKEKRAVNSLSMENANQENEEKEQV ANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARM REENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab167840 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • BEX2
    • Brain expressed X linked 1
    • HBEX2
    • Protein BEX1
    • Reduced expression protein 3
    • REX 3
    • REX3
    see all
  • Relevance
    Bex1 is a signaling adapter molecule involved in p75NTR/NGFR signaling. It is thought to play a role in cell cycle progression and neuronal differentiation. Bex1 inhibits neuronal differentiation in response to nerve growth factor (NGF). Bex1 has also been implicated as a tumor suppressor
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • 15% SDS-PAGE analysis of ab167840 (3 µg).

References

ab167840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up