Recombinant Human BHMT2 protein (denatured) (ab180277)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAPAGRPGAKKGILERLESGEVVIGDG SFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFS ASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEAR IKKLFRQQLEVFAWKNVDFLIAEYFEHVEEAVWAVEVLKESDRPVAVTMC IGPEGDMHDITPGECAVRLVKAGASIVGVNCRFGPDTSLKTMELMKEGLE WAGLKAHLMVQPLGFHAPDCGKEGFVDLPEYPFGLESRVATRWDIQKYAR EAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLD MHTKPWIRARARREYWENLLPASGRPFCPSLSKPDF
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 363
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_060084.

Specifications

Our Abpromise guarantee covers the use of ab180277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • Betaine homocysteine methyltransferase 2
    • Betaine homocysteine S methyltransferase 2
    • EC 2.1.1.5
    • FLJ20001
    • S methylmethionine homocysteine S methyltransferase BHMT2
    • SMM hcy methyltransferase
    see all
  • Relevance
    Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. BHMT2 is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida.
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab180277 (3μg).

References

ab180277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up