Overview

  • Product name
    Recombinant Human BICD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQ QYDELEAEYDSLKQELEQLK
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 70

Specifications

Our Abpromise guarantee covers the use of ab117012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Bic-D 1
    • Bicaudal D homolog 1
    • BICD
    • Bicd1
    • BICD1_HUMAN
    • Cytoskeleton like bicaudal D protein homolog 1
    • Protein bicaudal D homolog 1
    see all
  • Function
    Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.
  • Tissue specificity
    Expressed in the brain, heart and skeletal muscle.
  • Sequence similarities
    Belongs to the BicD family.
  • Post-translational
    modifications
    Isoform 3 is phosphorylated on Ser-865 and Thr-866.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt

Recombinant Human BICD1 protein images

  • 12.5% SDS-PAGE showing ab117012 at approximately 33.33kDa.
    Stained with Coomassie Blue.

References for Recombinant Human BICD1 protein (ab117012)

ab117012 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up