Overview

  • Product name
    Recombinant Human BICD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQ QYDELEAEYDSLKQELEQLK
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 70

Specifications

Our Abpromise guarantee covers the use of ab117012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Bic-D 1
    • Bicaudal D homolog 1
    • BICD
    • Bicd1
    • BICD1_HUMAN
    • Cytoskeleton like bicaudal D protein homolog 1
    • Protein bicaudal D homolog 1
    see all
  • Function
    Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.
  • Tissue specificity
    Expressed in the brain, heart and skeletal muscle.
  • Sequence similarities
    Belongs to the BicD family.
  • Post-translational
    modifications
    Isoform 3 is phosphorylated on Ser-865 and Thr-866.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117012 at approximately 33.33kDa.
    Stained with Coomassie Blue.

References

ab117012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up