Recombinant Human Biglycan protein (ab151798)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHC HLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYAL VLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDN RIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAK LTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIE NGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVND FCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKV DHHHHHH
    • Molecular weight
      43 kDa including tags
    • Amino acids
      20 to 368
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • BGN
    • Biglycan
    • Biglycan proteoglycan
    • Bone/cartilage proteoglycan I
    • Dermatan sulphate proteoglycan I
    • DSPG1
    • PG S1
    • PG-S1
    • PGI
    • PGS1_HUMAN
    • SEMDX
    • SLRR1A
    • Small leucine rich protein 1A
    see all
  • Function
    May be involved in collagen fiber assembly.
  • Tissue specificity
    Found in several connective tissues, especially in articular cartilages.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Post-translational
    modifications
    The two attached glycosaminoglycan chains can be either chondroitin sulfate or dermatan sulfate.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab151798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up