Recombinant Human Bim protein (ab112387)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43521
    • SpeciesHuman
    • SequenceMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSC DKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHS QDTEQLNHKDFS
    • Molecular weight39 kDa including tags
    • Amino acids1 to 112

Specifications

Our Abpromise guarantee covers the use of ab112387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

    Other

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • BCL2 like 11
    • B2L11_HUMAN
    • BAM
    • Bcl 2 interacting protein Bim
    • Bcl 2 related ovarian death agonist
    • Bcl-2-like protein 11
    • BCL2 interacting mediator of cell death
    • BCL2 like 11 (apoptosis facilitator)
    • BCL2 like protein 11
    • Bcl2-interacting mediator of cell death
    • Bcl2-L-11
    • Bcl2l11
    • BIM
    • BIM alpha6
    • BIM beta6
    • BIM beta7
    • BimEL
    • BimL
    • BOD
    see all
  • FunctionInduces apoptosis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than the isoforms BimEL, BimL and BimS. Isoform Bim-gamma induces apoptosis.
  • Tissue specificityIsoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.
  • Sequence similaritiesBelongs to the Bcl-2 family.
  • DomainThe BH3 motif is required for Bcl-2 binding and cytotoxicity.
  • Cellular localizationMitochondrion and Endomembrane system. Associated with intracytoplasmic membranes.
  • Information by UniProt

Recombinant Human Bim protein images

  • 12.5% SDS-PAGE analysis of ab112387. Stained with Coomassie Blue

References for Recombinant Human Bim protein (ab112387)

ab112387 has not yet been referenced specifically in any publications.

Product Wall

This product is Human Bim full-length ORF ( NP_996885.1, 1 a.a. - 112 a.a.) recombinant protein with a proprietary tag. Please contact our scientific support group for more information regarding this tag. We have not done any tests for enzymatic acti...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"