Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEMGSKGVTAGKIASNVQKKLTRAQEKVL QKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASK KLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYL GQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQ NLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIR VNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASE AASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTAT DTDELQLRAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVF PENFTERVP
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 439
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab98238 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AMPH 2
    • AMPH2
    • Amphiphysin 2
    • Amphiphysin II
    • Amphiphysin like protein
    • amphiphysin-like
    • Amphiphysin-like protein
    • AMPHL
    • Bin1
    • BIN1_HUMAN
    • Box Dependant MYC Interacting Protein 1
    • Box-dependent myc-interacting protein 1
    • Bridging integrator 1
    • DKFZp547F068
    • MGC10367
    • MGC105358
    • Myc box dependent interacting protein 1
    • Myc box-dependent-interacting protein 1
    • SH3P9
    see all
  • Function
    May be involved in regulation of synaptic vesicle endocytosis. May act as a tumor suppressor and inhibits malignant cell transformation.
  • Tissue specificity
    Ubiquitous. Highest expression in the brain and muscle. Isoform IIA is expressed only in the brain where it is concentrated in axon initial segments and nodes of Ranvier. Isoform BIN1 is widely expressed with highest expression in skeletal muscle.
  • Involvement in disease
    Defects in BIN1 are the cause of centronuclear myopathy autosomal recessive (ARCNM) [MIM:255200]; also known as autosomal recessive myotubular myopathy. Centronuclear myopathies are congenital muscle disorders characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers.
  • Sequence similarities
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Phosphorylated by protein kinase C.
  • Cellular localization
    Cytoplasm and Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98238

References

ab98238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up