Recombinant Human BLAP75 protein (ab153518)

Overview

  • Product name
    Recombinant Human BLAP75 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNK QVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAH SQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGME YQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEE YAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLAS LDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPS NLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIE RFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRS IFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILIERWSTM YRKGIHKFLMKMIVIYRVVL
    • Amino acids
      1 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BLAP75
    • BLM associated polypeptide 75 kDa
    • BLM associated protein 75 kDa
    • BLM-associated protein of 75 kDa
    • C9orf76
    • FAAP75
    • FLJ12888
    • Homolog of yeast RecQ mediated genome instability 1
    • RecQ mediated genome instability 1
    • RecQ-mediated genome instability protein 1
    • Rmi1
    • RMI1 homolog
    • RMI1 RecQ mediated genome instability 1 homolog
    • RMI1_HUMAN
    • RP11-346I8
    see all
  • Function
    Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. Promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. Required for BLM phosphorylation during mitosis. Within the BLM complex, required for BLM and TOP3A stability.
  • Sequence similarities
    Belongs to the RMI1 family.
  • Cellular localization
    Nucleus. Forms foci in response to DNA damage.
  • Information by UniProt

Images

  • ab153518 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up