Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected BTI-TN-5B1-4 cells
  • Amino Acid Sequence
    • AccessionP51451
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGLVSSKKPDKEKPIKEKDKGQWSPLKVSA QDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQML KGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQG RKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWA QDEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEA FLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCLLDFLKTDEGS RLSLPRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFG LARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVT YGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER PTFEFLQSVLEDFYTATERQYELQP
    • Molecular weight60 kDa including tags
    • Amino acids1 to 505
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 80 % SDS-PAGE.
    ab113606 was purified using conventional chromatography techniques. It is at least 80% pure by SDS PAGE.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • B lymphocyte kinase
    • B lymphoid tyrosine kinase
    • Blk
    • BLK nonreceptor tyrosine kinase
    • BLK_HUMAN
    • EC 2.7.10.2
    • MGC 10442
    • MGC10442
    • MODY 11
    • MODY11
    • P55 BLK
    • p55-BLK
    • Tyrosine kinase B lymphocyte specific
    • Tyrosine protein kinase
    • Tyrosine-protein kinase BLK
    see all
  • FunctionModulator of beta-cells function, acting through the up-regulation of PDX1 and NKX6-1 and consequent stimulation of insulin secretion in response to glucose.
  • Tissue specificityExpressed in lymphatic organs, pancreatic islets, Leydig cells, striate ducts of salivary glands and hair follicles.
  • Involvement in diseaseDefects in BLK are a cause of maturity-onset diabetes of the young type 11 (MODY11) [MIM:613375]. MODY11 is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Information by UniProt

Recombinant Human BLK protein images

  • 15% SDS-PAGE showing ab113606 (3 µg) at approximately 59.8 kDa.

References for Recombinant Human BLK protein (ab113606)

ab113606 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"