Recombinant Human BLMH protein (ab101205)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13867
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSSGLNSEKVAALIQKLNSDPQFVLAQNV GTTHDLLDICLKRATVQRAQHVFQHAVPQEGKPITNQKSS GRCWIFSCLNVMRLPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVD TAQRKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYT TEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQD VMMEEIFRVV CICLGNPPET FTWEYRDKDK NYQKIGPITP LEFYREHVKP LFNMEDKICL VNDPRPQHKY NKLYTVEYLS NMVGGRKTLY NNQPIDFLKK MVAASIKDGE AVWFGCDVGK HFNSKLGLSD MNLYDHELVF GVSLKNMNKA ERLTFGESLM THAMTFTAVS EKDDQDGAFT KWRVENSWGE DHGHKGYLCM TDEWFSEYVY EVVVDRKHVP EEVLAVLEQE PIILPAWDPM GALAE
    • Molecular weight55 kDa including tags
    • Amino acids1 to 475
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101205 was purified by using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • BH
    • Bleomycin hydrolase
    • BLM hydrolase
    • BLMH
    • BLMH_HUMAN
    • BMH
    • EC 3.4.22.40
    see all
  • FunctionThe normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
  • Sequence similaritiesBelongs to the peptidase C1 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human BLMH protein images

  • ab101205 (3 µg) analysed by 15% SDS PAGE.

References for Recombinant Human BLMH protein (ab101205)

ab101205 has not yet been referenced specifically in any publications.

Product Wall

Merci de nous avoir contactés.

Le laboratoire m'a confirmé que la protéine BLMH ab101205 est fournie sous sa forme active. Son activité spécifique d'hydrolyse du Met-AMC à pH 7,5 et à 37ºC ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"