Recombinant Human BLOC1S1 protein (ab152418)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAY MNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARS IELDMRTIATALEYVYKGQLQSAPS
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 125

Specifications

Our Abpromise guarantee covers the use of ab152418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Biogenesis of lysosome-related organelles complex 1 subunit 1
    • BL1S1_HUMAN
    • BLOC-1 subunit 1
    • Bloc1s1
    • BLOS1
    • GCN5-like protein 1
    • GCN5L1
    • Protein RT14
    • RT14
    see all
  • Function
    The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking.
  • Sequence similarities
    Belongs to the BLOC1S1 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152418 stained with Coomassie Blue.

References

ab152418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up